Wenn man sich bei der Massage zu sehr entspannt | Best of Pastewka - Staffel 2 Folge 7
Published 2023-05-24Download video
Recommendations
-
08:16 Anfassen ist erwünscht | Best of Pastewka - Staffel 2 Folge 1
-
10:33 Was wird aus der Tesla-Fabrik in Brandenburg? Reportage über Elon Musks Giga-Factory
-
00:07 Da war sie weg 😂😂😂 #cats #egal #shorts
-
07:41 Wenn du die Signale nicht rallst | Best of Pastewka - Staffel 3 Folge 2
-
06:59 High Protein Pastewka | Best of Pastewka - Staffel 2 Folge 6
-
15:35 Geht ja dann doch | Best of Pastewka - Staffel 7 Folge 1
-
11:40 Best of Anne und Bastian | Pastewka | Staffel 10 | Prime Video DE
-
04:02 Pornotitel vorlesen - TV total
-
08:06 Ottmar Zittlau ist überhaupt nicht lustig | Best of Pastewka - Staffel 2 Folge 4
-
09:47 Körperlicher Knock-out | Best of Pastewka - Staffel 7 Folge 8
-
05:29 Spülmaschine richtig einräumen | Johann König
-
05:05 Mit Lego den Lebensunterhalt bestreiten | Abendschau | BR24
-
06:04 Affäre mit Axel Stein, die Pille danach und andere Lügen | Best of Pastewka - Staffel 2 Folge 8
-
35:24 Das Beste von Anke Engelke & Bastian Pastewka | Empfehlung aus der Redaktion
-
08:51 Wenn man Johann König zufällig im Autohaus trifft | Best of Pastewka - Staffel 7 Folge 7
-
10:14 Die besten Szenen der zweiten LOL Staffel 😂2️⃣ | Last One Laughing Recap
-
15:05 Oldtimer: umweltfreundlicher als neue E-Autos der nostalgische Dreckschleudern? | DW Nachrichten
-
11:17 Operation: Parkhaus | Pastewka | Prime Video DE
-
07:56 Böser Traum und Fernsehhölle beim Grimmepreis | Best of Pastewka - Staffel 4 Folge 7
-
07:29 Aus Versehen gekauft | Best of Pastewka - Staffel 1 Folge 5
Similar videos
-
07:27 Keine plumpe Anmache: Bastian wird abgeschleppt | Best of Pastewka - Staffel 2 Folge 5
-
05:46 Let's get this Einweihungsparty started | Best of Pastewka - Staffel 2 Folge 9
-
04:07 Aber ohne Brunnen! | Best of Pastewka - Staffel 2 Folge 2
-
10:09 Du musst an Wunder glauben! | Best of Pastewka - Staffel 3 Folge 7
-
07:54 Es fehlt eine verdammte Köttbullar! | Best of Pastewka - Staffel 2 Folge 3
-
05:49 Kochen für Anfänger, Psychospielchen für Profis | Best of Pastewka - Staffel 3 Folge 8
-
08:41 Bisschen mehr Menschlichkeit | Best of Pastewka - Staffel 1 Folge 2
-
05:53 Straight aus dem Auto gekotzt | Best of Pastewka - Staffel 1 Folge 7
-
07:46 Ein Besucher zum Wahnsinnigwerden | Best of Pastewka - Staffel 3 Folge 5
-
08:07 Wenn du neidisch auf Hugo Egon Balder bist ... | Best of Pastewka - Staffel 1 Folge 8
-
07:23 Ein Hoch auf mich! | Best of Pastewka - Staffel 3 Folge 3
-
08:51 Kotzbrocken - aber einer, der gut aussieht | Best of Pastewka - Staffel 3 Folge 1
-
09:27 Oberweserdampfschifffahrtgesellschaftskapitän | Best of Pastewka - Staffel 1 Folge 3