Affäre mit Axel Stein, die Pille danach und andere Lügen | Best of Pastewka - Staffel 2 Folge 8 Published 2023-05-31 Download video MP4 360p Recommendations 05:46 Let's get this Einweihungsparty started | Best of Pastewka - Staffel 2 Folge 9 07:41 Wenn du die Signale nicht rallst | Best of Pastewka - Staffel 3 Folge 2 07:54 Die zwei Pappnasen und das Geheimnis um Elsa | Best of Pastewka - Staffel 3 Folge 4 04:11 The Pattern - Axel 29:08 Fußball-WM 1974: Kalter Krieg und riskante Flucht aus der DDR (1/2) | Die Story | Kontrovers | BR24 11:17 Operation: Parkhaus | Pastewka | Prime Video DE 06:49 SMS und Wein, lass das sein! | Best of Pastewka - Staffel 6 Folge 4 38:23 Wie Militärhilfen und Häftlinge Kiews Armee stärken sollen | Militärökonom Keupp bei ZDFheute live 08:51 Kotzbrocken - aber einer, der gut aussieht | Best of Pastewka - Staffel 3 Folge 1 05:10 Starallüren auf der lit.cologne | Best of Pastewka - Staffel 6 Folge 3 53:37 Arbeitslos! Kein Bock oder keine Chance? | Am Puls 06:14 Flohmarkt-Beziehungen: Wertlos oder unbezahlbar? | Best of Pastewka - Staffel 1 Folge 6 33:50 Russland soll Anti-Satelliten-Waffen ins All geschickt haben. Was steckt dahinter? | ZDFheute live 10:09 Entscheide dich: Familienfrieden oder Smartphone? | Best of Pastewka - Staffel 6 Folge Folge 7 11:40 Best of Anne und Bastian | Pastewka | Staffel 10 | Prime Video DE 03:43 "Hallo, ich bin der Hauptgewinn!" | Pastewka | Prime Video DE 25:09 Deutschlands Bürokratie-Problem | Markus Lanz vom 21. Mai 2024 39:40 Hitzige Diskussion über Reichtum und Gerechtigkeit | Markus Lanz vom 22. Mai 2024 07:23 Acht Punkte in Flensburg | Best of Pastewka - Staffel 4 Folge 6 01:58 Bastian kehrt aus Afrika zurück | Pastweka | Offizieller Trailer 2 | Prime Video DE Similar videos 07:19 Wenn man sich bei der Massage zu sehr entspannt | Best of Pastewka - Staffel 2 Folge 7 08:07 Wenn du neidisch auf Hugo Egon Balder bist ... | Best of Pastewka - Staffel 1 Folge 8 10:09 Du musst an Wunder glauben! | Best of Pastewka - Staffel 3 Folge 7 04:07 Aber ohne Brunnen! | Best of Pastewka - Staffel 2 Folge 2 07:23 Ein Hoch auf mich! | Best of Pastewka - Staffel 3 Folge 3 09:27 Oberweserdampfschifffahrtgesellschaftskapitän | Best of Pastewka - Staffel 1 Folge 3 06:59 High Protein Pastewka | Best of Pastewka - Staffel 2 Folge 6 08:06 Ottmar Zittlau ist überhaupt nicht lustig | Best of Pastewka - Staffel 2 Folge 4 07:27 Keine plumpe Anmache: Bastian wird abgeschleppt | Best of Pastewka - Staffel 2 Folge 5 07:54 Es fehlt eine verdammte Köttbullar! | Best of Pastewka - Staffel 2 Folge 3 09:55 Legalize it | Best of Pastewka - Staffel 4 Folge 1 05:53 Straight aus dem Auto gekotzt | Best of Pastewka - Staffel 1 Folge 7 07:30 Pastewka geht viral | Best of Pastewka - Staffel 6 Folge 5 04:09 Kein Mensch kennt mich besser als du | Best of Pastewka - Staffel 4 Folge 9 More results