Let's get this Einweihungsparty started | Best of Pastewka - Staffel 2 Folge 9
Published 2023-06-07Download video
Recommendations
-
07:27 Keine plumpe Anmache: Bastian wird abgeschleppt | Best of Pastewka - Staffel 2 Folge 5
-
07:19 Wenn man sich bei der Massage zu sehr entspannt | Best of Pastewka - Staffel 2 Folge 7
-
10:33 Was wird aus der Tesla-Fabrik in Brandenburg? Reportage über Elon Musks Giga-Factory
-
06:04 Affäre mit Axel Stein, die Pille danach und andere Lügen | Best of Pastewka - Staffel 2 Folge 8
-
07:05 Den falschen Promibonus ausnutzen | Best of Pastewka - Staffel 1 Folge 1
-
08:07 Wenn du neidisch auf Hugo Egon Balder bist ... | Best of Pastewka - Staffel 1 Folge 8
-
02:06 Schwachstellen in der Bewerbung | Ladykracher
-
11:17 Operation: Parkhaus | Pastewka | Prime Video DE
-
04:07 Olaf Schuberts "bester" Handwerkerwitz bei LOL: Last One Laughing
-
05:10 Starallüren auf der lit.cologne | Best of Pastewka - Staffel 6 Folge 3
-
07:41 Wenn du die Signale nicht rallst | Best of Pastewka - Staffel 3 Folge 2
-
07:21 Bastian wird von "Verstehen Sie Spaß?" reingelegt | Best of Pastewka - Staffel 4 Folge 4
-
09:04 In Holland gibt es die besten Puff... ertjes | Best of Pastewka - Staffel 7 Folge 4
-
06:20 Das Doppelleben eines Junkies | Best of Pastewka - Staffel 4 Folge 3
-
35:24 Das Beste von Anke Engelke & Bastian Pastewka | Empfehlung aus der Redaktion
-
11:11 Pastewka der Paten-Onkel | Pastewka | Prime Video DE
-
09:27 Oberweserdampfschifffahrtgesellschaftskapitän | Best of Pastewka - Staffel 1 Folge 3
-
03:12 Beziehungs-Probleme im Knast | Ladykracher
-
06:42 Der Traum vom Tatort-Kommissar | Best of Pastewka - Staffel 6 Folge 9
Similar videos
-
04:09 Kein Mensch kennt mich besser als du | Best of Pastewka - Staffel 4 Folge 9
-
04:07 Aber ohne Brunnen! | Best of Pastewka - Staffel 2 Folge 2
-
07:54 Es fehlt eine verdammte Köttbullar! | Best of Pastewka - Staffel 2 Folge 3
-
08:51 Kotzbrocken - aber einer, der gut aussieht | Best of Pastewka - Staffel 3 Folge 1
-
06:59 High Protein Pastewka | Best of Pastewka - Staffel 2 Folge 6
-
09:00 Karma regelt das | Best of Pastewka - Staffel 3 Folge 9
-
07:23 Ein Hoch auf mich! | Best of Pastewka - Staffel 3 Folge 3
-
08:06 Ottmar Zittlau ist überhaupt nicht lustig | Best of Pastewka - Staffel 2 Folge 4
-
05:53 Straight aus dem Auto gekotzt | Best of Pastewka - Staffel 1 Folge 7
-
09:55 Legalize it | Best of Pastewka - Staffel 4 Folge 1
-
05:49 Kochen für Anfänger, Psychospielchen für Profis | Best of Pastewka - Staffel 3 Folge 8
-
08:41 Bisschen mehr Menschlichkeit | Best of Pastewka - Staffel 1 Folge 2
-
09:18 Brisko Schneider steht vor meiner Tür | Best of Pastewka - Staffel 1 Folge 4